Recombinant Pongo abelii Transmembrane protein 168(TMEM168),partial

Specification
Organism Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q5RD28
Gene Names TMEM168
Alternative Names TMEM168; Transmembrane protein 168
Expression Region Partial(527-637aa )
Molecular Weight 19.8 kDa
Protein Sequence EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM168 family
Tissue Specificity TMEM168
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEPYX23867

Recombinant Pongo abelii Transmembrane protein 168(TMEM168),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pongo abelii Transmembrane protein 168(TMEM168),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.