Specification
| Organism | Plasmodium falciparum (isolate 3D7) |
| Expression Host | E.coli |
| Protein Tag | Tag-Free |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P86148 |
| Gene Names | PFD0110w |
| Alternative Names | |
| Expression Region | 24-269aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.18 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-110℃. |
| Protein Length | Partial |
| Molecular Weight | 30.1 kDa |
| Protein Sequence | QESYSSNEKIRKDYSDDNNYEPTPSYEKRKKEYGKDESYIKNYRGNNFSYDLSKNSSIFLHMGNGSNSKTLKRCNKKKNIKTNFLRPIEEEKTVLNNYVYKGVNFLDTIKRNDSSYKFDVYKDTSFLKNREYKELITMQYDYAYLEATKEVLYLIPKDKDYHKFYKNELEKILFNLKDSLKLLREGYIQSKLEMIRIHSDIDILNEFHQGNIINDNYFNNEIKKKKEDMEKYIREYNLYIYKYENQ |
Background
| Research Areas | Others |
| Relevance | Involved in reticulocyte adhesion. |
| Function | |
| Reference | "Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13." Hall N., Pain A., Berriman M., Churcher C.M., Harris B., Harris D., Mungall K.L., Bowman S., Atkin R., Baker S., Barron A., Brooks K., Buckee C.O., Burrows C., Cherevach I., Chillingworth C., Chillingworth T., Christodoulou Z. Barrell B.G. Nature 419:527-531(2002) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
