Specification
Organism | Plasmodium falciparum (isolate 3D7) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P50498 |
Gene Names | MSA2 |
Alternative Names | 45KDA merozoite surface antigen |
Expression Region | Partial(109-246aa ) |
Molecular Weight | 16.7 kDa |
Protein Sequence | NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May play a role in the merozoite attachment to the erythrocyte. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor |
Protein Families | |
Tissue Specificity | MSA2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |