Recombinant Plasmodium falciparum Merozoite surface antigen 2(MSA2),partial

Specification
Organism Plasmodium falciparum (isolate 3D7)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P50498
Gene Names MSA2
Alternative Names 45KDA merozoite surface antigen
Expression Region Partial(109-246aa )
Molecular Weight 16.7 kDa
Protein Sequence NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May play a role in the merozoite attachment to the erythrocyte.
Involvement in Disease
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
Tissue Specificity MSA2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYEWP343606

Recombinant Plasmodium falciparum Merozoite surface antigen 2(MSA2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Plasmodium falciparum Merozoite surface antigen 2(MSA2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.