Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P32307 |
| Gene Names | AVPR2 |
| Alternative Names | V2R Alternative name(s): AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor |
| Expression Region | Partial(292-370aa ) |
| Molecular Weight | 24.7 kDa |
| Protein Sequence | WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily |
| Tissue Specificity | AVPR2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |