Specification
Organism | Sus scrofa (Pig) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P17630 |
Gene Names | TCN1 |
Alternative Names | CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCI |
Expression Region | Full Length of Mature Protein(25-416aa ) |
Molecular Weight | 46.3 kDa |
Protein Sequence | CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide. |
Involvement in Disease | |
Subcellular Location | Secreted |
Protein Families | Eukaryotic cobalamin transport proteins family |
Tissue Specificity | TCN1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |