Recombinant Pig Transcobalamin-1(TCN1)

Specification
Organism Sus scrofa (Pig)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P17630
Gene Names TCN1
Alternative Names CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCI
Expression Region Full Length of Mature Protein(25-416aa )
Molecular Weight 46.3 kDa
Protein Sequence CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.
Involvement in Disease
Subcellular Location Secreted
Protein Families Eukaryotic cobalamin transport proteins family
Tissue Specificity TCN1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PY7PI23442

Recombinant Pig Transcobalamin-1(TCN1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pig Transcobalamin-1(TCN1)
Copyright © 2021-present Echo Biosystems. All rights reserved.