Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | A7LCJ3 |
| Gene Names | SIGLEC1 |
| Alternative Names | pSn;Sialic acid-binding Ig-like lectin 1;Siglec-1;p210 |
| Expression Region | Partial(20-153aa ) |
| Molecular Weight | 22.3 kDa |
| Protein Sequence | SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2,3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis (By similarity). Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages through a clathrin-coated dependent process. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | SIGLEC1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |