Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O18766 |
| Gene Names | RHO |
| Alternative Names | RHO1 |
| Expression Region | Partial(1-36aa ) |
| Molecular Weight | 31.2 kDa |
| Protein Sequence | MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling |
| Involvement in Disease | |
| Subcellular Location | Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment |
| Protein Families | G-protein coupled receptor 1 family, Opsin subfamily |
| Tissue Specificity | RHO |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
