Specification
Organism | Sus scrofa (Pig) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P15782 |
Gene Names | SFTPB |
Alternative Names | 8 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe) |
Expression Region | Full Length(1-79aa ) |
Molecular Weight | 8.7 kDa |
Protein Sequence | FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Miscellaneous Pulmonary surfactant consists of 90% lipid and 10% protein. There are 4 surfactant-associated proteins: 2 collagenous, carbohydrate-binding glycoproteins (SP-A and SP-D) and 2 small hydrophobic proteins (SP-B and SP-C). |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | SFTPB |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |