Recombinant Pig Parathyroid hormone(PTH)

Specification
Organism Sus scrofa (Pig)
Expression Host Mammalian cell
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P50133
Gene Names PTH
Alternative Names GTR2-2 Intestinal protein OCI-5 MXR7
Expression Region Full Length of Mature Protein(32-115aa )
Molecular Weight 13.6 kDa
Protein Sequence MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity).
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity PTH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$396.00
In stock
SKU
EB-PM7PI19112

Recombinant Pig Parathyroid hormone(PTH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pig Parathyroid hormone(PTH)
Copyright © 2021-present Echo Biosystems. All rights reserved.