Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P50133 |
| Gene Names | PTH |
| Alternative Names | GTR2-2 Intestinal protein OCI-5 MXR7 |
| Expression Region | Full Length of Mature Protein(32-115aa ) |
| Molecular Weight | 13.6 kDa |
| Protein Sequence | MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 2 family |
| Tissue Specificity | PTH |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |