Specification
| Organism | Sus scrofa (Pig) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9TUB5 |
| Gene Names | CLCA1 |
| Alternative Names | Calcium-activated chloride channel family member 1 pCLCA1 AECC |
| Expression Region | Partial(46-199aa ) |
| Molecular Weight | 22.8 kDa |
| Protein Sequence | DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells. |
| Involvement in Disease | |
| Subcellular Location | Secreted, extracellular space |
| Protein Families | CLCR family |
| Tissue Specificity | CLCA1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |