Specification
| Organism | Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P59368 |
| Gene Names | PNTx4 |
| Alternative Names | Insecticidal neurotoxin Tx4(6-1) Short name:PNTx4(6-1) |
| Expression Region | Full Length of Mature Protein(35-82aa ) |
| Molecular Weight | 7.3 kDa |
| Protein Sequence | CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Spider toxin Tx2 family |
| Tissue Specificity | PNTx4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |