Specification
| Organism | Pan troglodytes (Chimpanzee) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q862Z7 |
| Gene Names | LTB |
| Alternative Names | Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3 |
| Expression Region | Extracellular Domain(49-244aa ) |
| Molecular Weight | 36.8 kDa |
| Protein Sequence | QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface . |
| Involvement in Disease | |
| Subcellular Location | Membrane, Single-pass type II membrane protein |
| Protein Families | Tumor necrosis factor family |
| Tissue Specificity | LTB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
