Specification
| Organism | Oxyopes takobius (Lynx spider) (Oxyopes foliiformis) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | F8J4S0 |
| Gene Names | N/A |
| Alternative Names | Oxt-4a |
| Expression Region | Full Length of Mature Protein(48-77aa ) |
| Molecular Weight | 19.6 kDa |
| Protein Sequence | GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 µM) and B.subtilis (MIC=0.5 µM) as well as Gram-negative bacteria P.fluorescens (MIC=1 µM) and E.coli (MIC=0.5 µM). Has hemolytic activity against human erythrocytes (EC(50)=7 µM) |
| Involvement in Disease | |
| Subcellular Location | Secreted, Target cell membrane |
| Protein Families | |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |