Specification
| Organism | Oryza sativa subsp. japonica (Rice) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q10N20 |
| Gene Names | MPK5 |
| Alternative Names | Benzothiadiazole-induced MAP kinase 1 MAP kinase 2 Multiple stress-responsive MAP kinase 2 OsBIMK1 OsMAP1 OsMAPK2 OsMAPK5 OsMPK3 OsMSRMK2 BIMK1, MAPK2, MAPK5, MPK3, MSRMK2 |
| Expression Region | Full Length(1-369aa ) |
| Molecular Weight | 48 kDa |
| Protein Sequence | MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance. Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Cytoplasm |
| Protein Families | Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily |
| Tissue Specificity | MPK5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
