Recombinant Ornithodoros moubata Tick anticoagulant peptide

Specification
Organism Ornithodoros moubata (Soft tick) (Argasid tick)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P17726
Gene Names N/A
Alternative Names ; Tick anticoagulant peptide; TAP
Expression Region Full Length(1-60aa )
Molecular Weight 9 kDa
Protein Sequence YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYOCK325650

Recombinant Ornithodoros moubata Tick anticoagulant peptide

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Ornithodoros moubata Tick anticoagulant peptide
Copyright © 2021-present Echo Biosystems. All rights reserved.