Specification
| Organism | Ophiostoma ulmi (Dutch elm disease fungus) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q06153 |
| Gene Names | CU |
| Alternative Names | Dutch elm disease toxin |
| Expression Region | Full Length of Mature Protein(26-100aa ) |
| Molecular Weight | 9.6 kDa |
| Protein Sequence | SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss. |
| Involvement in Disease | |
| Subcellular Location | Secreted, cell wall |
| Protein Families | Cerato-ulmin hydrophobin family |
| Tissue Specificity | CU |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |