Specification
| Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-KSI-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q92093 |
| Gene Names | vtg1 |
| Alternative Names | (VTG) |
| Expression Region | 1465-1595aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.33 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-125℃. |
| Protein Length | Partial |
| Molecular Weight | 30.1 kDa |
| Protein Sequence | VNEMEISNDNLPYKDPSGSIKIDRKGKGVSLYAPSHGLQEVYFDKYSWKIKVVDWMKGQTCGLCGKADGENRQEYRTPSGRLTKSSVSFAHSWVLPSDSCRDASECLMKLESVKLEKQVIVDDRESKCYSV |
Background
| Research Areas | Signal Transduction |
| Relevance | Precursor of the major egg-yolk proteins that are sources of nutrients during early development of oviparous organisms. |
| Function | |
| Reference | "Isolation and characterization of a vitellogenin cDNA from rainbow trout (Oncorhynchus mykiss) and the complete sequence of a phosvitin coding segment." Goulas A., Triplett E.L., Taborsky G. DNA Cell Biol. 15:605-616(1996) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |