Recombinant Oncorhynchus mykiss Vitellogenin(vtg1),partial

Specification
Organism Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Expression Host E.coli
Protein Tag N-terminal 6xHis-KSI-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID Q92093
Gene Names vtg1
Alternative Names (VTG)
Expression Region 1465-1595aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.33 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-125℃.
Protein Length Partial
Molecular Weight 30.1 kDa
Protein Sequence VNEMEISNDNLPYKDPSGSIKIDRKGKGVSLYAPSHGLQEVYFDKYSWKIKVVDWMKGQTCGLCGKADGENRQEYRTPSGRLTKSSVSFAHSWVLPSDSCRDASECLMKLESVKLEKQVIVDDRESKCYSV
Background
Research Areas Signal Transduction
Relevance Precursor of the major egg-yolk proteins that are sources of nutrients during early development of oviparous organisms.
Function
Reference "Isolation and characterization of a vitellogenin cDNA from rainbow trout (Oncorhynchus mykiss) and the complete sequence of a phosvitin coding segment." Goulas A., Triplett E.L., Taborsky G. DNA Cell Biol. 15:605-616(1996)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$378.00
In stock
SKU
EB-N231046

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Oncorhynchus mykiss Vitellogenin(vtg1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.