Specification
Organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P79826 |
Gene Names | plp |
Alternative Names | DM20Lipophilin |
Expression Region | Partial(150-218aa ) |
Molecular Weight | 11.7 kDa |
Protein Sequence | PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | Myelin proteolipid protein family |
Tissue Specificity | plp |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |