Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial

Specification
Organism Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P79826
Gene Names plp
Alternative Names DM20Lipophilin
Expression Region Partial(150-218aa )
Molecular Weight 11.7 kDa
Protein Sequence PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Myelin proteolipid protein family
Tissue Specificity plp
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEOEI18327

Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Oncorhynchus mykiss Myelin proteolipid protein(plp),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.