Specification
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P41746 |
| Gene Names | rodA |
| Alternative Names | Rodlet protein |
| Expression Region | Full Length of Mature Protein(19-159aa ) |
| Molecular Weight | 28.3 kDa |
| Protein Sequence | LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia. |
| Involvement in Disease | |
| Subcellular Location | Secreted, cell wall |
| Protein Families | Fungal hydrophobin family |
| Tissue Specificity | rodA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |