Specification
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0C956 |
| Gene Names | gel4 |
| Alternative Names | Glucan elongating glucanosyltransferase 4 |
| Expression Region | Full Length of Mature Protein(26-519aa ) |
| Molecular Weight | 57.5 kDa |
| Protein Sequence | KVLKACCWTIALDANSYGNKFFYSNNGTEFFIRGVAYQQEYQANGTSTENSDYTDPLANVDNCKRDIPYLKQLRTNVIRTYAVDPTKDHDECMKLLDDAGIYLITDLSAPSESINRADPAWNTDLYKRYTSVIDAFAKYSNVIGFFAGNEVANDNNNTNSIAYVKAAVRDMKSYIKSKDYRSSLLVGYATDDDAHIRADLADYLVCGDKESSIDMFGYNIYEWCGDSSFEKSGYKDRTEEFSKYPVPAFFSEYGCIDPKPRKFTDVAALYGPQMNDVWSGGIVYMYFQEANDYGLVSVSGDNVKTKEDFSYLSVQMQKVTATGVNSASYTASNTAVPTCPSVGAKWEASNKLPPSPNSELCDCMVETLSCTVKDSVDEKEYGDLFDYLCAAGVCGGINSNSTSGDYGAYSVCSAKQKLSFVMNQYYKKNNKAATACDFDGKAQTKKGADASGSCASLISQAGTAGTGSVTAGATGSSGSGSASETSKGAAGVAA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis (By similarity). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | gel4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |