Recombinant Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase(lpxA)

Specification
Organism Neisseria meningitidis serogroup C (strain 053442)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A9M3T0
Gene Names lpxA
Alternative Names Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase(UDP-N-acetylglucosamine acyltransferase)(EC 2.3.1.129)
Expression Region Full Length(1-258aa )
Molecular Weight 34.2 kDa
Protein Sequence MTLIHPTAVIDPKAELDSSVKVGAYTVIGPNVQIGANTEIGPHAVINGHTSIGENNRIFQFASLGEIPQDKKYRDEPTRLIIGNGNTIREFTTFNLGTVTGIGETRIGDDNWIMAYCHLAHDCVVGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGDYAMTAFAAGVHKDVPPYFMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQAELAVFRDFFAQSARGIIR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity lpxA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PENEW434821

Recombinant Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase(lpxA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase(lpxA)
Copyright © 2021-present Echo Biosystems. All rights reserved.