Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB(porB)

Specification
Organism Neisseria meningitidis serogroup B
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P30687
Gene Names porB
Alternative Names Class 3 protein Porin
Expression Region Full Length of Mature Protein(20-331aa )
Molecular Weight 37.8 kDa
Protein Sequence DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQENVNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSFDATNYNNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGESKFVSTAGGVGLRHKF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serves as a slightly cation selective porin. GO - Molecular functioni
Involvement in Disease
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Gram-negative porin family
Tissue Specificity porB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PENBK335694

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB(porB)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB(porB)
Copyright © 2021-present Echo Biosystems. All rights reserved.