Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha(ihfA)

Specification
Organism Neisseria meningitidis serogroup B (strain MC58)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P64393
Gene Names ihfA
Alternative Names /
Expression Region Full Length(1-100aa )
Molecular Weight 15.5 kDa
Protein Sequence MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKSMVEHYYDKQR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ihfA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PENGG351557

Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha(ihfA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha(ihfA)
Copyright © 2021-present Echo Biosystems. All rights reserved.