Recombinant Naja atra Cytotoxin 3b

Specification
Uniprot ID Q98960
Gene Names N/A
Alternative Names (Cardiotoxin 3b)
Organism Naja atra (Chinese cobra)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight 14.2 kDa
Expression Region Full Length of Mature Protein(22-81aa )
Expression Region N-terminal 10xHis-tagged and C-terminal Myc-tagged(Full Length of Mature Protein )
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Not test.
Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Background
Research Areas Others
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$427.00
In stock
SKU
EB-ENFG2571804

Recombinant Naja atra Cytotoxin 3b

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Naja atra Cytotoxin 3b
Copyright © 2021-present Echo Biosystems. All rights reserved.