Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083(MPN_083),partial

Specification
Organism Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P75610
Gene Names MPN_083
Alternative Names Uncharacterized lipoprotein MPN_083
Expression Region Partial(22-242aa )
Molecular Weight 41.2 kDa
Protein Sequence CSFKDYIPTPSFRKDFSTENNFVKNKVPGKDDIYSKFYDLTFSLNFVNNQAQEFGTGWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANLFTAYIATNLHVADGLKNDQDYAPYNKDGWGQPYPYQQKTQSFLLGKYTKPNVQLVKTNYEKPEDAVIEQKLKEDSLLFIQTSTLPKTAYAAIDPVNFSYNPTRTNGFWTAGKYNVYNGGNSIGNY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Cell membrane, Lipid-anchor
Protein Families MG067/MG068/MG395 family
Tissue Specificity MPN_083
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEMLW303569

Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083(MPN_083),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083(MPN_083),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.