Specification
| Organism | Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q11132 |
| Gene Names | map |
| Alternative Names | Short name:MAPUniRule annotation Short name:MetAPUniRule annotation Alternative name(s): Peptidase M |
| Expression Region | Full Length(1-248aa ) |
| Molecular Weight | 43.7 kDa |
| Protein Sequence | MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Peptidase M24A family, Methionine aminopeptidase type 1 subfamily |
| Tissue Specificity | map |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
