Specification
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O33348 |
| Gene Names | relG |
| Alternative Names | Putative endoribonuclease RelG |
| Expression Region | Full Length(1-87aa ) |
| Molecular Weight | 26.2 kDa |
| Protein Sequence | MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Toxic component of a toxin-antitoxin (TA) module. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides. Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis). Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | RelE toxin family |
| Tissue Specificity | relG |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |