Recombinant Mycobacterium tuberculosis Malate synthase G(glcB),partial

Specification
Organism Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID A5U3K4
Gene Names glcB
Alternative Names glcB; MRA_1848Malate synthase G; EC 2.3.3.9
Expression Region Partial(136-263aa )
Molecular Weight 13.4 kDa
Protein Sequence GSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Malate synthase family, GlcB subfamily
Tissue Specificity glcB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PEMON404112

Recombinant Mycobacterium tuberculosis Malate synthase G(glcB),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mycobacterium tuberculosis Malate synthase G(glcB),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.