Specification
Organism | Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | A5U3K4 |
Gene Names | glcB |
Alternative Names | glcB; MRA_1848Malate synthase G; EC 2.3.3.9 |
Expression Region | Partial(136-263aa ) |
Molecular Weight | 13.4 kDa |
Protein Sequence | GSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Malate synthase family, GlcB subfamily |
Tissue Specificity | glcB |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |