Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin(hbhA)

Specification
Organism Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P9WIP8
Gene Names hbhA
Alternative Names Adhesin
Expression Region Full Length of Mature Protein(2-199aa )
Molecular Weight 28.8 kDa
Protein Sequence AENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Required for extrapulmonary dissemination. Mediates adherence to epithelial cells by binding to sulfated glycoconjugates present at the surface of these cells (By similarity).
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity hbhA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEMVZ358835

Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin(hbhA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin(hbhA)
Copyright © 2021-present Echo Biosystems. All rights reserved.