Specification
| Organism | Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P24596 |
| Gene Names | N/A |
| Alternative Names | Minor structural protein VP2 |
| Expression Region | Full Length of Mature Protein(2-324aa ) |
| Molecular Weight | 41.4 kDa |
| Protein Sequence | GAFLAVLAEVFDLASITGLSVESILSGEALTTAELLQSHINNLVVYGGLTEAEALAAVEVTPQAFAALTSLFPNFPQALGALAATEFTATGALTVGAAVSAALYPYYWDYRTPVADLNMALQIWYPDLDILFPGALPFARFVNYIDPANWAADLYRAVGRYFWERVQAAGINFIEQQMETGRELAMRSVTSLSETLSQYFENARWAVSGLSTSLYHGLESYYSQLGLSPIQQRQLARNLGHPQPYRYDLYDAPQLKGQVSATYVTKVDPPGGANQRSAPDWMLPLLLGLYGDLTPSWKDTLEELEAEEDGSHSQKAKRRKTKA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly (By similarity). Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus (By similarity). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |