Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q62059 |
| Gene Names | Vcan |
| Alternative Names | Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2) |
| Expression Region | Partial(24-146aa ) |
| Molecular Weight | 20.9 kDa |
| Protein Sequence | AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
| Involvement in Disease | |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Aggrecan/versican proteoglycan family |
| Tissue Specificity | Vcan |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |