Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a) ,partial

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal Flag-Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O08759
Gene Names Ube3a
Alternative Names Oncogenic protein-associated protein E6-AP
Expression Region Partial(542-870aa )
Molecular Weight 40.9 kDa
Protein Sequence NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo (By similarity). Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990)
Involvement in Disease
Subcellular Location Cytoplasm, Nucleus
Protein Families
Tissue Specificity Ube3a
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$396.00
In stock
SKU
EB-PM8MO25613

Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.