Recombinant Mouse Ubiquitin-like protein FUBI (Fau)

Specification
Uniprot ID P35545
Gene Names Fau
Alternative Names (Monoclonal non-specific suppressor factor beta)(MNSF-beta)
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular Weight 15.2 kDa
Expression Region Full Length(1-74aa )
Expression Region N-terminal 10xHis-tagged and C-terminal Myc-tagged(Full Length )
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Not test.
Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG
Background
Research Areas Cell Biology
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$337.00
In stock
SKU
EB-E8MO991374

Recombinant Mouse Ubiquitin-like protein FUBI (Fau)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Ubiquitin-like protein FUBI (Fau)
Copyright © 2021-present Echo Biosystems. All rights reserved.