Recombinant Mouse Tyrosine-protein kinase Mer(Mertk),partial (Active)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Protein Tag C-terminal 10xHis-tagged
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Level Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Measured by its binding ability in a functional ELISA. Please contact us for the specific data.
Uniprot ID Q60805
Gene Names Mertk
Alternative Names (Proto-oncogene c-Mer)(Receptor tyrosine kinase MerTK)
Expression Region 19-497aa
Product Form Lyophilized powder
Buffer Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.18
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-379℃.
Protein Length Partial
Molecular Weight 55.0 kDa
Protein Sequence GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM
Background
Research Areas Neuroscience
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$222.00
In stock
SKU
EB-N231300

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Tyrosine-protein kinase Mer(Mertk),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.