Recombinant Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17),partial

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O88472
Gene Names Tnfrsf17
Alternative Names B-cell maturation protein (CD_antigen: CD269) (Bcm) (Bcma)
Expression Region Partial(1-54aa )
Molecular Weight 34.8 kDa
Protein Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Tnfrsf17
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMMO1239866

Recombinant Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.