Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Fc-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q80WM9 |
| Uniprot Entry Name | |
| Gene Names | Tnfrsf14 |
| Alternative Names | Tnfrsf14; Herpesvirus entry mediator;HVEM; TR2;TNF receptor-like molecule;ATAR;another TRAF-associated receptor;Tumor necrosis factor receptor superfamily member 14 |
| Expression Region | Partial (39-207aa) |
| Molecular Weight | 45.6 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Mouse Protein Tnfrsf14, is a type I transmembrane protein belonging to the TNF receptor superfamily. It is tumor necrosis factor receptor superfamily member 14 and expressed on the surface of T cells during the resting state. Interaction of HVEM with TNF family member LIGHT co-stimulates T cells and promotes inflammation. HVEM also triggers inhibitory signaling cascade in effector T (Teff) cells and regulatory T cells (Tregs) as a ligand of B and T lymphocyte attenuator. Tnfrsf14 is detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. It has demonstrated that HVEM Ig is able to exert a significant antiviral effect against HSV-1 infection in vivo. |
| Function | |
| Involvement in disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |