Recombinant Mouse Transthyretin(Ttr),partial

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07309
Gene Names Ttr
Alternative Names Prealbumin
Expression Region Partial(23-147aa )
Molecular Weight 13.5 kDa
Protein Sequence AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Involvement in Disease
Subcellular Location Secreted
Protein Families Transthyretin family
Tissue Specificity Ttr
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PE1e12527136

Recombinant Mouse Transthyretin(Ttr),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Transthyretin(Ttr),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.