Specification
Organism | Mus musculus (Mouse) |
Expression Host | in vitro E.coli expression system |
Tag Info | N-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P50637 |
Gene Names | Tspo |
Alternative Names | Mitochondrial benzodiazepine receptor (PKBS) (Peripheral-type benzodiazepine receptor) (PBR) (Bzrp) (Mbr) |
Expression Region | Full Length(1-169aa ) |
Molecular Weight | 21.7 kDa |
Protein Sequence | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | Tspo |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |