Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99LJ1 |
| Gene Names | Fuca1 |
| Alternative Names | Alpha-L-fucosidase I Alpha-L-fucoside fucohydrolase 1 |
| Expression Region | Full Length of Mature Protein(18-452aa ) |
| Molecular Weight | 66.6 kDa |
| Protein Sequence | LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. |
| Involvement in Disease | |
| Subcellular Location | Lysosome |
| Protein Families | Glycosyl hydrolase 29 family |
| Tissue Specificity | Fuca1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |