Recombinant Mouse Thymosin beta-10(Tmsb10)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q6ZWY8
Gene Names Tmsb10
Alternative Names Tmsb10;Ptmb10
Expression Region Full Length of Mature Protein(2-44aa )
Molecular Weight 17.8 kDa
Protein Sequence ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Tmsb10
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE6MO765221

Recombinant Mouse Thymosin beta-10(Tmsb10)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Thymosin beta-10(Tmsb10)
Copyright © 2021-present Echo Biosystems. All rights reserved.