Specification
Organism | Mus musculus (Mouse) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9CQU0 |
Gene Names | Txndc12 |
Alternative Names | Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19 |
Expression Region | Full Length of Mature Protein(25-170aa ) |
Molecular Weight | 20.5 kDa |
Protein Sequence | RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Possesses significant protein thiol-disulfide oxidase activity. |
Involvement in Disease | |
Subcellular Location | Endoplasmic reticulum lumen |
Protein Families | |
Tissue Specificity | Txndc12 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |