Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P40224 |
| Gene Names | Cxcl12 |
| Alternative Names | 12-O-tetradecanoylphorbol 13-acetate repressed protein 1 ;TPAR1C-X-C motif chemokine 12;Pre-B cell growth-stimulating factor ;PBSFThymic lymphoma cell-stimulating factor ;TLSF |
| Expression Region | Partial(22-89aa ) |
| Molecular Weight | 12 kDa |
| Protein Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Choattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chotaxis. Also binds to atypical chokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells . Has several critical functions during bryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.Stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of the stromal cell-dependent B-cell clone DW34 cells. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | Cxcl12 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |