Recombinant Mouse Stanniocalcin-2(Stc2)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID O88452
Gene Names Stc2
Alternative Names Stc2; Stanniocalcin-2; STC-2
Expression Region Full Length of Mature Protein(25-296aa )
Molecular Weight 30.1 kDa
Protein Sequence TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has an anti-hypocalcemic action on calcium and phosphate homeostasis.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Stc2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$499.00
In stock
SKU
EB-PE2MO22947

Recombinant Mouse Stanniocalcin-2(Stc2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Stanniocalcin-2(Stc2)
Copyright © 2021-present Echo Biosystems. All rights reserved.