Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P17809 |
| Gene Names | Slc2a1 |
| Alternative Names | Glucose transporter type 1, erythrocyte/brain |
| Expression Region | Partial(451-492aa ) |
| Molecular Weight | 4.5 kDa |
| Protein Sequence | KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:17320047). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity). |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | Slc2a1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
