Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9CQK8 |
| Gene Names | Sprr2a |
| Alternative Names | Sprr2a1; Sprr2a; Small proline-rich protein 2A1; small proline-rich protein 2A |
| Expression Region | Full Length(1-83aa ) |
| Molecular Weight | 13.4 kDa |
| Protein Sequence | MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | Cornifin (SPRR) family |
| Tissue Specificity | Sprr2a |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |