Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9JLZ8 |
| Gene Names | Sigirr |
| Alternative Names | Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8 |
| Expression Region | Full Length(1-117aa ) |
| Molecular Weight | 14.7 kDa |
| Protein Sequence | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Membrane, Single-pass type III membrane protein |
| Protein Families | Interleukin-1 receptor family |
| Tissue Specificity | Sigirr |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
