Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P31532 |
| Gene Names | Saa4 |
| Alternative Names | (Amyloid A-5 protein) |
| Expression Region | 19-130aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.20 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-112℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 19.2 kDa |
| Protein Sequence | DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF |
Background
| Research Areas | Cardiovascular |
| Relevance | Major acute phase reactant. |
| Function | |
| Reference | "Structure of the mouse serum amyloid A 5 (Saa5) gene: relationship to other members of the serum amyloid A family." Butler A., Whitehead A.S. Scand. J. Immunol. 45:160-165(1997) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |