Recombinant Mouse Serine/threonine-protein kinase VRK1(Vrk1)

Specification
Organism Mus musculus (Mouse)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q80X41
Gene Names Vrk1
Alternative Names Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1
Expression Region Full Length(1-440aa )
Molecular Weight 55.2 kDa
Protein Sequence MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity
Involvement in Disease
Subcellular Location Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, spindle
Protein Families Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily
Tissue Specificity Vrk1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE2MO769027

Recombinant Mouse Serine/threonine-protein kinase VRK1(Vrk1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Serine/threonine-protein kinase VRK1(Vrk1)
Copyright © 2021-present Echo Biosystems. All rights reserved.