Specification
| Organism | Mus musculus (Mouse) |
| Expression Host | Mammalian cell |
| Protein Tag | C-terminal hFc-tagged |
| Purity | Greater than 94% as determined by SDS-PAGE. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
| Uniprot ID | Q00724 |
| Gene Names | Rbp4 |
| Alternative Names | (Plasma retinol-binding protein)(PRBP)(RBP) |
| Expression Region | 19-201aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.15 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-376℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 50.3 kDa |
| Protein Sequence | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
Background
| Research Areas | Cancer |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
