Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Specification
Organism Mus musculus (Mouse)
Expression Host Mammalian cell
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q3TCN2
Gene Names Plbd2
Alternative Names 66.3KDA protein76KDA protein ;p76LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2
Expression Region Full Length of Mature Protein(47-594aa )
Molecular Weight 65.9 kDa
Protein Sequence LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Putative phospholipase.
Involvement in Disease
Subcellular Location Lysosome lumen
Protein Families Phospholipase B-like family
Tissue Specificity Plbd2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$396.00
In stock
SKU
EB-PM3MO663748

Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
Copyright © 2021-present Echo Biosystems. All rights reserved.